PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_A0676BAEA.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 119aa    MW: 13821.7 Da    PI: 11.522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_A0676BAEA.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.34.9e-201663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd+llvd++ ++G g+W++ ar+ g++Rt+k+c++rw++ l
  Traes_3DS_A0676BAEA.1 16 RGAWTAEEDLLLVDYISRHGEGRWNSLARCAGLRRTGKSCRLRWLNNL 63
                           89*******************************************975 PP

2Myb_DNA-binding55.51.3e-1769112146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg  T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Traes_3DS_A0676BAEA.1  69 RGHITPEEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 112
                            6778******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3191163IPR017930Myb domain
SuperFamilySSF466893.21E-3114110IPR009057Homeodomain-like
SMARTSM007173.0E-151565IPR001005SANT/Myb domain
PfamPF002492.3E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-231770IPR009057Homeodomain-like
CDDcd001671.21E-111863No hitNo description
PROSITE patternPS0017503140IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129423.78364118IPR017930Myb domain
SMARTSM007179.1E-1568116IPR001005SANT/Myb domain
PfamPF002493.6E-1669112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2371116IPR009057Homeodomain-like
CDDcd001671.70E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MSPAGSSAVT TGDLRRGAWT AEEDLLLVDY ISRHGEGRWN SLARCAGLRR TGKSCRLRWL  60
NNLRPDVRRG HITPEEQLLI LDLHSRWGNR WSKIAQHLPG RTDNEIKNYW RTRVQKHAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-26711218122MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5872671e-118EF587267.1 Triticum aestivum R2R3 Myb-like protein (PIMP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692470.14e-67PREDICTED: LOW QUALITY PROTEIN: anthocyanin regulatory C1 protein
RefseqXP_003569075.15e-67PREDICTED: protein ODORANT1
SwissprotP813913e-61MYB05_ANTMA; Myb-related protein 305
TrEMBLW5DIX41e-82W5DIX4_WHEAT; Uncharacterized protein
STRINGOB05G12230.11e-66(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.14e-62myb domain protein 21
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]